SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 633699.FI9785_1170 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  633699.FI9785_1170
Domain Number 1 Region: 4-210
Classification Level Classification E-value
Superfamily CAC2185-like 6.28e-66
Family CAC2185-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 633699.FI9785_1170
Sequence length 214
Comment (Lactobacillus johnsonii FI9785)
Sequence
MKKELIEKIDKIGRYFKDSRDIKRLENKDFTIFSSNCIGGIMYHNLHLKFLSPTINLWIE
PADYVAMLRDPKKYFVSGKMVEVKDSTLPYPVGSIYGKRIYGEHYKNFEELSFKWDQRVQ
RINWNNIYVFFIERDGATIEDLTNFDTLPFNKVVFTKKEYPELKNSIVLPNTFDNEKNEV
NNLCGKINRFSRLRYIDEFDYVNFFNNGSIILKK
Download sequence
Identical sequences D0R4L8
WP_012846307.1.28407 gi|268319642|ref|YP_003293298.1| 633699.FI9785_1170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]