SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 634176.NT05HA_0701 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  634176.NT05HA_0701
Domain Number 1 Region: 3-208
Classification Level Classification E-value
Superfamily CAC2185-like 1.7e-83
Family CAC2185-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 634176.NT05HA_0701
Sequence length 209
Comment (Aggregatibacter aphrophilus NJ8700)
Sequence
MSLFSKIKRAVNKFHRKSINQELKNRLTNHNMSVLSSNCVGAFILHDLNEPFNSPFVNLY
VKPRDFIRYLQNMVHYDRQTLVFEPTDKPYPVGILGDIPIHFMHYHSAQEAQEKWETRLK
RLNLDNLFIIMTDKDGAVGVTYEDLVAFDNLPFKNKVVFTNKPYPELASAFYIKGFEQET
QVGDLFDFSGWNGAKYYDQFDYVAWFNQP
Download sequence
Identical sequences A0A0N2CXX5
gi|251792459|ref|YP_003007185.1| 634176.NT05HA_0701 WP_005700392.1.19963 WP_005700392.1.60119 WP_005700392.1.9014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]