SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 63737.Npun_F2307 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  63737.Npun_F2307
Domain Number 1 Region: 12-156
Classification Level Classification E-value
Superfamily ARM repeat 3.06e-21
Family PBS lyase HEAT-like repeat 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 63737.Npun_F2307
Sequence length 203
Comment (Nostoc punctiforme PCC 73102)
Sequence
MNNQDATAIPMEQIKARLYSTDQDTSALALGELIRLGKKATPVLLEALTNPNPRTRRLAA
EGLSEIADPASADALFQATHDTNPEVRARAATALHQLGDKRSLSALVATLDDYPDILHNP
YTASMYPLMRGGKEVLPLVIPLLQAPNDLTRERAFLIVKAVVSKLPQGQDWNQLWQSLGS
YDPAGQKAERDKAAQQWQEWLSK
Download sequence
Identical sequences B2J7F8
gi|186682640|ref|YP_001865836.1| 63737.Npun_F2307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]