SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 63737.Npun_F3316 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  63737.Npun_F3316
Domain Number 1 Region: 167-327
Classification Level Classification E-value
Superfamily ARM repeat 2.43e-18
Family PBS lyase HEAT-like repeat 0.086
Further Details:      
 
Domain Number 2 Region: 370-406
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000188
Family Pectin methylesterase 0.034
Further Details:      
 
Weak hits

Sequence:  63737.Npun_F3316
Domain Number - Region: 67-97
Classification Level Classification E-value
Superfamily TPR-like 0.000818
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 63737.Npun_F3316
Sequence length 406
Comment (Nostoc punctiforme PCC 73102)
Sequence
MIAAIRQKIRSAYADNPHLALCHWFHEFDNYVDSDNFAVCEGLLSEICKEAYPPLAAKEQ
AYVDSREGVLWLKKGIEHHKQSRFEEAQNYYQKSLKIQQRVQCRDAQTNVKVFQSVLAED
CLNGTPSYLKLDSFAQELHVLGGSESLLCDRLSTSTTPEERSQILFAAVQARLTKPLVQA
FRSPDEQTRMMGIAGLGRFKQINETQVLLEGLYDSNWFVRWRAAEALAHQIVICSACNSE
NPIGIKSCQACPADINLPEVTTDLFIQKLCAVLDRETSPDVRRVLVMLLGQTNNTGVTLT
LLAALDDSDADVRIAVIEALGKIGVPSGTIEKLRNVSDGKSLLGGSIKETLEKIIGTIAD
QSLRSETAIATYIVSQDGDGDYGTISKAIASVPPGSRILVQPGLYN
Download sequence
Identical sequences B2IZY3
63737.Npun_F3316 WP_012409732.1.44837 gi|186683501|ref|YP_001866697.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]