SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 63737.Npun_R2916 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  63737.Npun_R2916
Domain Number 1 Region: 17-301
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-55
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 413-525
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.7e-29
Family Pentapeptide repeats 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 63737.Npun_R2916
Sequence length 534
Comment (Nostoc punctiforme PCC 73102)
Sequence
MSYCLNPICPNPENLVNSQSCQSCGSQLLLRDRYQAIKPLGQGGFGATFLANDRGLPGEP
SCVIKQLRPSGSAPHVLQMARELFEREAKTLGKIGNHPQVPRLLDYFEDHEQFYLVQEYI
SGDTLQEEVKLNGILTETGVKQFLSEILPLLQYIHEQKVIHRDIKPANLIRRTQDARMVL
IDFGAVKNQVTQGAISQSGQTALTAYAIGTPGFAPPEQMAMRPVYASDIYALGVTCIYLL
TSKTPKDLDYNPNTGEMIWEQLVQVSDHLSNVLRKMLDVSVRNRYQSAAEVLRALEIEPY
LESLAKGLLIKSDTGSKERTHNHLENSAVLCNNSSVAVTSAGVAQVAAAIRARRAKAAEA
AGSHHASGMGKSTTLANSNSNGSQVQNSKVERKLDTQGLLTAYQKGRRDFALHNLSLLNL
QGADLSGTNFHSTQLQKTNLQGANLHNSDFGRASLSKANLKDANLTKAYFNHADLEGADL
RGADLSNAYLSNANLRGANLCGANLTSAKISDEQLALAKTNWMTIRPNGKRGLL
Download sequence
Identical sequences B2IWJ4
gi|186683195|ref|YP_001866391.1| WP_012409439.1.44837 63737.Npun_R2916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]