SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 64091.VNG6371G from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  64091.VNG6371G
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0000000000000225
Family MRR-like 0.04
Further Details:      
 
Weak hits

Sequence:  64091.VNG6371G
Domain Number - Region: 323-377
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00316
Family PHD domain 0.08
Further Details:      
 
Domain Number - Region: 221-294,371-399
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 0.0108
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 64091.VNG6371G
Sequence length 439
Comment (Halobacterium sp)
Sequence
MEDVFRTLGYENVRQAEKTADEGRDVIMEEVVDGTRRAIVVECKHTGTVGRPVVQKLHSA
IATFDFDGPKRGMVVTTGRFTSPAQEYADRLQQNNDPHPIELLDGEDLREIADEIGLDLY
NGRIEILCDETLRPYDPATDLDAPIQEAFHDIENIEAADLPTPHSAVTFRPVVAVTADTN
AVFETSVGVIHRINDQTRFVAHAERGQPQVVDENVATLVTENLHATVVLDSEQLGEIFDE
VEERRFGQTQTGYKEWTVERLQQHHTTTVTYTGDNNVTYNKTCEPNLSDISVQSIEPVFL
PEVRQMTEIQEYTYPYEYYAAGPSRVTAEDGIHQCVYCDTSGVDETYTYCPNCGAIACST
HIKTERLEGEPICTGCAVTERFALKTKYFYDGQNLEAFREEYADMPLHEKTMENKWLAGG
SVVATLLLVVGLLVIGGII
Download sequence
Identical sequences Q9HHJ0
gi|16120267|ref|NP_395855.1| gi|16120267|ref|NP_395855.1|NC_002608 64091.VNG6371G

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]