SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 644223.PAS_chr4_0851 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  644223.PAS_chr4_0851
Domain Number - Region: 199-276
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0262
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 644223.PAS_chr4_0851
Sequence length 374
Comment (Pichia pastoris GS115)
Sequence
MTTVSFQKIMVFPRIAIQDILNYDTPNCIVPMSGSSSASNSIDTGTESVSTEGEPGGSPD
GMEGEKESNTDPEGAEQLDPSSQYRYSFEVSLPYFSKLVLARKCHQLSKHTANTKFSNKI
SSQNGKRGRPYSLLINARLMVYSDLQSILSSLHKSLYDIHEYDMRNIPAVCKSPSSPAPT
EQDQLLESISRLLGCSSSLFDSHVVANTNFRALKYDCKNNSMSFLQYMDKIVQSEKYKFV
KTIRDYNGKLVKLEIIDKPNFHSNLKNMEWLKEHACFPRYKANMKIHVMLHEDTQDSNSC
ASDDSEILFYNEPRLFLHDLIYNNYGISKEDVPDLLRGSVSHLRLRLGYWADKRVLINRE
NFTEHLSSFLHHDY
Download sequence
Identical sequences C4R944 F2QXZ9
gi|254574378|ref|XP_002494298.1| XP_002494298.1.19831 644223.PAS_chr4_0851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]