SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 64471.sync_0364 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  64471.sync_0364
Domain Number 1 Region: 16-242
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.32e-45
Family Decarboxylase 0.0007
Further Details:      
 
Domain Number 2 Region: 289-478
Classification Level Classification E-value
Superfamily PRTase-like 1.44e-38
Family Phosphoribosyltransferases (PRTases) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 64471.sync_0364
Sequence length 484
Comment (Synechococcus CC9311)
Sequence
MLRSWADLRGLNGRSLLSQARSWCKSVIEETADHVCAYKPSLGFYQAMGSAGVELLLEVR
ELLPPDLPLIIDIKHGDLNSSSAIAAYLFQSLHADAVTLNPFAGQDIAAPFLLYPGKGVF
INCHSSNPAAHDLQHHPNDHNPFYLKVVRESQSWGTPEQLLLEVGTSDPAILADVRQAAP
ERFVMLRSLWGEEGNLQCLLKNGLNKMGDGLLIPLPQNLLNGNNINEQTSTLKGRINRIR
DQHLQERAHTDAIHPEQCRIWPHSDQSNQDDSITTVREDGVKPIDQDLWDLVIDLYDIRC
LLFGEFKQASGEIFNYYIDLRQIISDPALFHRVLDCYAQVLRPLRFDRIAGIPYGSLPTA
TGLSLQLHKPLIYPRKEVKAHGTRRMVEGEFKKGETVAVVDDILITGGSVMEGISKLESS
GLNVRDVVVFLDHGGIHDLRAKQRLQSHGVKLQAVLTLDTISHVLETSDRISPDQAQELR
HTEK
Download sequence
Identical sequences Q0ID76
64471.sync_0364 gi|113952716|ref|YP_729596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]