SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 65393.PCC7424_1189 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  65393.PCC7424_1189
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.24e-54
Family Methylesterase CheB, C-terminal domain 0.0000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 65393.PCC7424_1189
Sequence length 338
Comment (Cyanothece PCC 7424)
Sequence
MLGRIIVIGASAGGVEALRELVAGFPSDLPATIFIVLHISPNSGSVLPSILTRAGVLEAV
YPENEEVFQPGRIYVAPPDHHLLVKLGKVELTRGPKENRNRPAIDVLFRSAARAYDSLVI
GVVLSGLLDDGTAGLLAIKQRGGIAIVQDPEEALYSSMPRNAIENVEVDQVLSVKEIAKE
LTRLVYEPIELKEVPPVSKNFAMESDMATLEPEAMQSDERPGIPSGFACPDCGGVLWELN
QGNLLRFRCRTGHAFSVESLLAQQSEELEEALWVALRTLEETANLRDRMAQRATQAGHTA
RARIYDEDAQTARQRALLIRKAILNGLNGKNKDQLDEA
Download sequence
Identical sequences B7K771
65393.PCC7424_1189 WP_012598585.1.63236 gi|218438178|ref|YP_002376507.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]