SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 67593.JGI129379 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI129379
Domain Number 1 Region: 172-243
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000128
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 2 Region: 71-98
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000863
Family CCCH zinc finger 0.0028
Further Details:      
 
Weak hits

Sequence:  67593.JGI129379
Domain Number - Region: 119-139
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000114
Family CCCH zinc finger 0.0054
Further Details:      
 
Domain Number - Region: 270-296
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00127
Family CCCH zinc finger 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI129379
Sequence length 378
Comment (Phytophthora sojae)
Sequence
MRRSTSRSRYSASASARGASTERDRVFDNLQRRLAAQDLSDRGAEAEDVYEDKRSVPQAA
RSSPAAAAAVPTTALCRFFVLGKCRYGSRCTYSHALPEQVSECAADEAEGLSAAAALVDC
PFFLRGNCKYGEHCRLRHNPAMLLGAATSARAAPRAGRPSGAGYTSSNNAAVNATAATRE
DNQQDFTCGICFDDIIQSGKHFGLLSCDHCFCLDCLREWRQSKDMELEVIRACPACRVPS
DFIVPSLIFCKGEEKRKVVEAYKSHLALRECKYFNGLFGSCPFGPRCFYAHRDAEGRDVK
HLDRPKRSMKPRRGRNGRQGGDAALQSLLQQYSHLFRFFEVADWDDFDLVGGLYDSDDSD
DDYFEYNYGFSDDEFDSD
Download sequence
Identical sequences jgi|Physo1_1|129379|estExt_fgenesh1_pg.C_70204 67593.JGI129379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]