SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 67593.JGI130507 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI130507
Domain Number 1 Region: 442-545
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000288
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Weak hits

Sequence:  67593.JGI130507
Domain Number - Region: 268-348
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00262
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI130507
Sequence length 553
Comment (Phytophthora sojae)
Sequence
MAALRYGDEMGLEERALVLTERLIALDQVKEWKHLVKTELAQPEYPLDQVQSLRPSTTVE
NPLMYCLLEKMGLLGLIKRTVIDLHCEAMQSVAAASKKQVKLASDDSRLLPGAQTTNGCS
LDVVRAARDNWERITSDEMLRVAKELGRPLVAPKAAAPSSGGSEASARDDAQMPPAAEAE
GTKPAKATKVLAARFLYDGYEVPISLGSIQLQLYSPPFHEYRRLFPELAPGCGQIGLDEL
FPAQRSAFLAEKNRVGDLVLAHQSVSMARQYSKTGCPVSLRPQIWRQVLSVPVTTQDRSH
FEHLKTQAAQWTYLTDDMYLLDLQQTIDSSDYFVFQDHLESVLMAFTRDTYVKGHALQVN
GTVHGSLAGTESKPDEAANEDSDSSVPPNGVLPFSGLVMYMAPLAYLYADPVELYIIFRE
LYARYWSKLNAIRTERGTILPLCKLFEDLVVRSSPAAVFHLINIGVKPLDIAFPWIQSAF
SGTLDIDQVLLLWDRVIGYDSLELVAIFAAALFHFRASELETVNSREEAEELFAELIDIH
VVTLLQEYLFGLP
Download sequence
Identical sequences 67593.JGI130507 jgi|Physo1_1|130507|estExt_fgenesh1_pg.C_110176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]