SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 67593.JGI134050 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI134050
Domain Number 1 Region: 73-203
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.73e-25
Family Cell cycle control phosphatase, catalytic domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI134050
Sequence length 278
Comment (Phytophthora sojae)
Sequence
MQLEGEPFEGVQIEAAGGPNREVQLKRAVSSQTMLTSSFSPAPVVPPRLLRHQASEQSIS
VMAASAPPPEPILPTVYSSRHPDLNVITPETVVRVLRGEYEGQLAGFQLLDCRFPFEFEG
GSLHGATSLCDPDAMEAKFFVSTELETYTRTALIFFCEFSANRAPKMLRHVRNVDRRVHA
DSYPELYYPELYLIDGGYKNCFETLPMELCASSAEYIRMEDERFADACRREFAAWRRRWK
PHKTVANCAANLEKGQRLHQGQDRSQLMHGVRSLFDAL
Download sequence
Identical sequences 67593.JGI134050 jgi|Physo1_1|134050|estExt_fgenesh1_pg.C_290117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]