SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 67593.JGI138679 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI138679
Domain Number 1 Region: 159-330
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.73e-36
Family Ypt/Rab-GAP domain of gyp1p 0.005
Further Details:      
 
Domain Number 2 Region: 306-403
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.71e-28
Family Ypt/Rab-GAP domain of gyp1p 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI138679
Sequence length 556
Comment (Phytophthora sojae)
Sequence
MARAKTTTLDGSTMGGAGHAAPPAAARAHGRHLACFRPKRRFRLAKAASLQEPLEDVAAG
RLDLACHCERQVLQCLADAQDQSDAALATAEDLYRYRLRKWGERFAARDWAQERVCQKWK
ENQKRFTQQAPDDASNTKKAPAGKSVKMAFSTFATAAELMLHSRQFDALLKAGVSPQLRG
QVWWMCSGAAELRRAAKESYPALLHRLHTLSKCAEMDIEKDLPRTFPLSLRSSMRQSQEL
SEDGDHFGELRRVLQAYSLRNPTVGYCQSMNFLAAVLLQQMGEEEAFWVLASIVEELTPQ
YHTRTMTGSRADQRVFSDLVTQKLPVLANHLQTLGVDFEPFTLKWFLCLFLNTLPFEPVM
RIWDVFFCEGSHVLLRVGLVLLKLNQPRIMACDDALDVYEMFKVSHETLQELTAPYRSGL
LNRDECVCDTLMRLTMDKSFLGTIPFDSLHELRQYYQGEIEAELQEAEERRLERQRSAES
KRRGSEANNRCSSPGDSEDRALMMEYDFVDDYACSSGSEGSPARQIRFMDLYDSDDSTGD
YFVDVMYGFSLGHHSR
Download sequence
Identical sequences 67593.JGI138679 jgi|Physo1_1|138679|estExt_fgenesh1_pg.C_650098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]