SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 67593.JGI158154 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI158154
Domain Number 1 Region: 196-399
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.6e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0000145
Further Details:      
 
Domain Number 2 Region: 375-498
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.23e-35
Family Ypt/Rab-GAP domain of gyp1p 0.0000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI158154
Sequence length 514
Comment (Phytophthora sojae)
Sequence
MFTAPMEAAADNRPATEDMMQPSPSPPQGATSNPFKTALHKFAQKKKERAAASSLSNAAT
SSFFSRGNNKAPAQQKPQALPGSVKQVNTGQLPPVWATPSPAPPRKLSSPVDSASPRLRS
LSSADSETDDAASRSVDHSGRNRHSLHEDELEEEAHGTPTHGHANGNKGAPLTANSVLPS
ASSSRNASGNLRYTQFERLLEKEVVDLDQLRKLSWGGVPTKHRPTVWRLLLGYMPPKQDR
RAAMLERKRQEYVELLQQYYYIPDTDRGTREQTTLRQILVDIPRTNADVKLFQNERIHQL
QYRSLVAIVSSGYVQGINDLMTPFLVVFLSAFIDEPQTCDLSEVSDENLQIVEADSYWCL
TKLLDDIQDHYTFAQPGLQRMVQRMEELVHRCDAELFEHIVERENVQFVQFAFRWMNCLL
MRELPLDGIVRIWDTYLCEDSGFESFHVYVCAAILMTFGEALKTLEFQDLVLFLQSLPTK
DWVENEIEPLLSRAFILQTYFADAPSHLSSQAAQ
Download sequence
Identical sequences jgi|Physo1_1|158154|C_scaffold_86000006 67593.JGI158154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]