SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 688245.CtCNB1_3249 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  688245.CtCNB1_3249
Domain Number 1 Region: 5-128
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 7.06e-59
Family PA2201 N-terminal domain-like 0.0000755
Further Details:      
 
Domain Number 2 Region: 137-209
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 0.000000000000126
Family PA2201 C-terminal domain-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 688245.CtCNB1_3249
Sequence length 210
Comment (Comamonas testosteroni CNB 1)
Sequence
MSQTFQHHGQLAAACAEWAKISLTGLQPRRNLNLSDKKADWKEALSALKRFANSDSYKAH
QNFQAHAALENYWKWKEVGEQARWLLIYGIDLGLCGDVLRPIYQEVVALWIDAASVAEHA
RASMAQETGEDYGVGAPINTRADDYAVAVTLLSLATLLDAQDDVPAIDEHVLAFDTDQLL
DYLCAGGLQLQQVSEELFHKRPYGAMKPFF
Download sequence
Identical sequences D0J2M2
688245.CtCNB1_3249 gi|264679384|ref|YP_003279291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]