SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000000084 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000000084
Domain Number 1 Region: 908-1051
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-18
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 618-660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000311
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 3 Region: 1056-1102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family EGF-type module 0.027
Further Details:      
 
Domain Number 4 Region: 785-841
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000389
Family EGF-type module 0.006
Further Details:      
 
Domain Number 5 Region: 872-923
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 6 Region: 696-740
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000802
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000000084
Domain Number - Region: 1090-1130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000503
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 830-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000943
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 130-179
Classification Level Classification E-value
Superfamily FnI-like domain 0.00188
Family VWC domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000000084
Sequence length 1249
Comment (Gasterosteus aculeatus)
Sequence
WLLSSTMNIQRAALFLSGLVLCMDTCLGQKDCTGVDCPVLQRCIETVLEEGSCCPACTQR
GCTCEGYQYYDCVQGGFRKGKVPEGGAYFVDFGSTECVCPAGGGKISCNFIPCPEIPPNC
VDVLQPADGCPRCGQIGCTHGRKKYNAGHSFQRDRCQVCHCPDEGGRLMCSPIPSCDLRA
SNKPVWATTTENNGPLRDISSRHDGRQTSPGEGLSELALRNTLPLYKQDPPSLGTGDYDY
RLEGPTSSTIQDLAQLLESTKIPPTYAKASSTSFSSLDDGRHETQRRSDSETSSQAEAAH
DTHPTTAGGRGEISTTATATTQRVTTGTRKKKAKEAKKSRPQIPPCSSTPPAEVLSDDPK
PAKTTTPRMLRGSLKSCSSSQAKKNTRSKCHPYLLNIKTCAADAGKPQKVETRNEQISSV
LVCARASEYITHNKAHGCTKWDKAGFPAKEPLKTCCETGEKWASANGHCNNMEPPTKDRN
SICWTAQQQCCRGALSEGRCSAGMDAAKAGNMCREAAGDRCGIDSYKECCDCCSLGLLFL
REGHRCEAPQHLGFHCRHIFLTCCKEEEEEQEALYRTPTDPLAPQNKVVSDSPYPKEAFS
IGEERHGENAAEGPGEVEDMDECLIYEGSICHHRCVNTAGSYRCECLPGYALQEDAFTCA
QETVDEENRLKEDDGAAAAAHPLARPPPTQPAGPPNPCEGNGPCEHYCTSVGGRPQCSCF
PGFSLGMADGRSCQEDTDVISFHSHNKTLRQTGRSDSRLLNFYCELSPFLSSSLSPYFIS
SFLHPDVNECLLGNVCRLGERCVNTAGSYICQRPVACPPGFQSNNGVCEDIDECVQQSHD
CGLDFQCVNTEGSFRCSPKPRCAAGFNRDLQGNCIDIDECGALARPCSLGFDCINTVGSY
MCQRKIICSRGYHASPDGSRCVDVDECQGGLHQCGEGQLCHNQPGSYRCECQAGYQYDSF
RRTCVDVNECWRYPGRLCAQTCENTPGSFQCSCTSGFRLSGDGKNCEDVNECLAGPCGQE
CANIYGSYQCYCRQGYQLREDGHTCEDVDECSRGIGHHCTYKCVNVPGSYQCACPEYGYT
MSANGRSCRDVDECATGAHNCSLAQTCYNILGGYRCLHVDCPPNYRKVSDTRCERISCPN
YLDCQNSPLRITYYYISFQSNIVLPAQIFRIGPSPAYSGDNVIVSITQGNEEGRFSTRKL
NAYTGAVYLNRQAEGPRDFSLNVEMKLWRQGTFTTFQAKIFVFITANSL
Download sequence
Identical sequences G3N466
69293.ENSGACP00000000084 ENSGACP00000000084 ENSGACP00000000084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]