SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000001015 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000001015
Domain Number 1 Region: 627-876
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-63
Family Protein kinases, catalytic subunit 0.00000432
Further Details:      
 
Domain Number 2 Region: 318-410
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000298
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 3 Region: 49-198
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000723
Family Ephrin receptor ligand binding domain 0.0031
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000001015
Domain Number - Region: 238-306
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00154
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000001015
Sequence length 883
Comment (Gasterosteus aculeatus)
Sequence
SCPVVLHPLLLVFGTPSFLPSHLTSTGPDMKDGGLQDQMRRMGDYIVPYPSHQREKIKSG
NENTCPIQDIKDYNLNPATDNHWVTGMLIRWMERKGARHLLMDVSFAQEEEPSHQLTPLK
VYLFDSNTPIARFQNTQAVLDLQTSKAFPVTVPPNQVSRYLNRSRALSLGSVSSRGFHLA
LSYSGRCVLIASIRLYYRRCPYTVANLASFEATGAASGPLKGSCVKGAVELFPPVRECDV
DGVWSPVQGGCNCKAGHQVMEDTCQVCRMGFYKPINGSGECRPCPQNSRTHGEGTEKCDC
LQDFNRLPTDPYELGCTKPPSAPVNLTVYYPNVSVLMVTWDPPQDWGGRHEIKYSIKCEW
EADSGHRWKACGDDVIFLPYSAGLTNTSVSITEVNPQLNYRLTVQAQNDLSDLRGTLASS
TATITIHRYVFNTLNHPGKDCKKQATSSQGWPVFVRVMQWQKFYFGNTTCSNDQSYTSLK
SQHLNVTPGHCKYGDFSLLEKSQMATAGKVPPVEITVTSDLNVSKHHIVPAAEPSRLYMW
LTVGVLFGLLLLGAVFPFAVCVLRSHYTKLRQETINFVFDSQNRMLKSPRIRAFAHECTF
QPTSTAAGGCTSDVQHVTPRFLAVSSAGEFGSVYEGVFTLDEGGDIKVAVKTMRVGIHSQ
EDLHEFLREADIMKNFDHENVVGLLENIQTCYPEILIASYLRSHPSPTFFQFVPHQSLLR
FGIDIAAGMAYLSAKGFLHRDLAARNCMLGDDLRVCVADFGLSKKIYSSNYYRQKATIRV
PIKWMAIESLSESIYSSKSDVWSFGVTMWEIVSRGRTPYPGVHNHELLELLLSGHRLKPP
EDCDHNLYEVMQSCWDKEPSRRPDFKELGEILKGLLSELPALK
Download sequence
Identical sequences G3N6U0
ENSGACP00000001015 69293.ENSGACP00000001015 ENSGACP00000001015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]