SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000002201 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000002201
Domain Number 1 Region: 293-415
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000102
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 65-205
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000251
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 3 Region: 167-286
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000706
Family Growth factor receptor domain 0.014
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000002201
Domain Number - Region: 1393-1422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0644
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 525-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 961-1010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family Laminin-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000002201
Sequence length 1537
Comment (Gasterosteus aculeatus)
Sequence
PNVCVEREVTLVAQRQPCVQAFTRMVKVWKQGCAAQSWCMGYERRTAYYTAYRQVYRQDY
QTVHKCCPGWSQLNGEAGCLYHVNECEETNGACEALCCNTIGSYYCRCPAGQKLNEDGKS
CQDIDECQVHNGGCQHRCVNTRGSYYCECHPGSRLHVDGRTCLAVHSCAVSNGGCEHYCM
QQSAAHFRCRCKANYVLAEDGKHCKLQNPCADQNGGCVHECRADGGKAHCDCKAGYILAE
DGKTCQDVDECEKEADCAHGCRNTLGSYACVCNAAYELGSDGKHCYRIEMEIVNSCENNN
GGCSHHCQHSTSGPVCSCNHGYRLDDDLKTCADVDECGEQSSCCEQDCTNYPGGYECYCS
AGYRLDNDGCSCDDVDECLASNGGCDHTCQNSAGSFQCFCRRGFRLDEDRQSCIPLEDAI
EALSSGAAIELPLIQPLLTLMQDYNQPLERYDDYEDDDGELRAESNLAEKFVCLDDTFGS
DCSLTCDDCSNGGKCNSWKNGCDCPAGWMGVVCNQTCPEGYFGKNCSFPSKCKNGATCDP
ITGSCRCPPGVSGDVCQDGCPKGFYGKQCNKKCNCANNGRCHRTYGACLCDPGLYGRFCH
LPCPKWTFGPGCSDECQCVQQNTLQCHRRHGTCVCKSGYQGNTCEEECKPGTYGAGCAKK
CSCPLGVSCNHVTGACQRKCPPGRHGENCDQDCPVGRFGAGCVHPCNCTGSPCDKVSGRC
KCPAGTAGKRCENLCPDGFWGSGCTETCPACENGGVCDKHNGSCNCPSGLMGRLCQNSCP
SGRFGQACQMKCVCENNARCDPVAGRCTCAPGWTGHNCRKGCDAGHWGEDCAETCDCRNG
DGSCDGVTGQCNCEAGYTGTRCHQKCPAGMFGLGCRRRCQCDNNALCDHVSGACTCQVGW
TGTFCEKPCPPGFYGLDCQEKCSCLNGGSCDHVSGLCSCPAGWIGSSCDLTCPTGFYGEG
CNQTCSCRNDGICHPASGQCVCTPGWTGPNCTEECPPGFYGGDCQQRCLCQNGATCNKST
GKCSCASGWTGTACELAGRFGRDCQQQCECENGGQCDALTGRCSCSGGWVGGRCERACEA
GLFGAGCEERCRCVHGDSCHHVTGACRCLPGWRGKLCDKACLPGMFGEGCMHHCACAQGT
SCHHVSGDCGCPPGFKGNGCEQTCLPGTFGQNCNQVCRCSETNQLCHPVSGLCYCAPGFH
GRRCDQICRKGRYGLNCESECQCENGGRCIPSTGACDCPAGFIGASCNITCPAGRYGVNC
ARVELCGDGAQNDPVTGRCKCVAGRRGSDCAHGCLPGWFGAECVERCNCSNGGVCDSVTG
GCMCSLGWTGSHCNKECPEGRFGANCQLKCNCQNNSTCDRVTGTCRCGPGYYGQLCEHAC
PPGLHGPLCQLQCDCMNGASCHPASGACVCPPGYHGARCHRVCEQGTFGHGCANVCDCEE
DSPCDPVRGRCLCSSGRTGLKCDIECRENRFGPDCAETCQCGNGSQCDRRNGRCSCLHSW
IGLTCQEGTVDLHASPTAGEETRSMRTRYSTGADFFY
Download sequence
Identical sequences G3NA58
ENSGACP00000002201 69293.ENSGACP00000002201 ENSGACP00000002201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]