SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000002652 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000002652
Domain Number 1 Region: 38-243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.73e-36
Family Laminin G-like module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000002652
Sequence length 1806
Comment (Gasterosteus aculeatus)
Sequence
MEMWSTRWKTKRWFMDSTVTAFVTLTLVLQGANVGAAEPVDLLKLLGFQNDPEGVTKTSG
ICTNRRASKPDLAYRVTKEIQISAPTSQLFPGDVFPEDFSILTTVRPKSGLQSFLLSIYN
TEGVQQLGVEVGRSPVFLYEDQTGKPAPEDYPLFRTLNLADGKWHRVAISVEKKTVTIIV
DCKTRIIKPLLRSDHGAISTDGITVFGTRLLDVEVFQGDIQQLLIVADPKAAYDYCEHYS
PDCDTPHGESLQAQEPQEEYTTDDLDYSQFYEYSEGATDIAPTDEYSEPQVNEKIFNMTQ
PNNVGDYNTDFDYGTVDGTQTQSPFATSGPEEQMNPLEPFRHRTLKTGDNLDTGADAYDF
KEYDLKEYDLGEVDNRVYEYGAYDEYGRARPDPTDSDDEEVGPGVAAETDVSGSTVAGGA
YGQKGDKGEPAVIEPGMLIEGPPGTPGPAGLPGPSGLQGPPGPSGDPGDRGPPGRAGLPG
ADGLAGPPGTMLMLPTSRLMNGFNDGEKGPVVSAQEAQAQAILSQARLAMRGPSGPMGLT
GRSGPVGLPGSPGLKGDAGDHGPQGPRGVQGAPGQVGKPGKRGRAGADGSRGMPGEPGSK
GDRGFDGLPGLPGEKGHRGEPGPMGPTGASGEDGQRGEDGEIGPRGLAGESGPRGLLGPR
GPPGPPGSPGVAGVDGPPGAKGNMGPQGEPGPPGQQGIPGTQGLPGPQGPIGPPGEKGPH
GRSGLPGLPGADGPPGHPGKEGPPGEKGALGPLGPQGPIGYPGPRGVKGADGVRGLKGSK
GEKGEDGFPGFKGDMGIKGDRGELGMVGSRGEDGPEGPKGRSGPNGDTGPLGPAGEKGKL
GVPGLPGYPGRQGPKGSSGFPGFPGANGEKGARGLAGKVGPRGQRGPTGPRGSRGARGPT
GKPGPKGTAGNDGPPGGPGERGPQGPQGPVGFSGPKGPPGPPGKDGLPGHPGQRGETGFQ
GKTGPPGPGGVVGPQGPTGETGPVGERGHPGPPGPPGEQGLPGAAGKEGAKGDPGPQGSS
GKDGPPGLRGFPGERGVPGATGPAGLKGGEGPQGPPGPVGSPGERGHAGSAGPIGLSGRP
GPQGPPGPAGEKGAPGEKGPQGPAGRDGVQGPVGLPGPAGPQGPPGEDGDKGEVGEPGQK
GSKADKGEQGPPGPAGLQGPIGAPGPAGADGEPGPRGQQGMFGQKGDEGSRGFPGPPGPI
GLQGLPGPPGEKGENGDVGPMGPPGPPGPRGPQGPSGADGPQGPPGGVGPMGSVGEKGEQ
GEAGNPGPPGEAGTGGPKGERGEKGEAGPSGAAGPAGAKGPPGDDGPKGNPGPVGFPGDP
GPPGEPGVAGTDGESGEKGEDGEAGQPGPPGPSGEAGPPGPPGKRGPPGTAGSEGRQGEK
GAKGEAGAEGPAGKTGPVGPQGPSGKPGPEGLRGIPGPVGEQGLPGSPGQDGPPGPMGPP
GLPGLKGDPGSKGEKGHPGLMGLVGPSGEQGEKGDRGLPGPQGSPGGKGDGGISGSSGPI
GPPGPPGLPGPQGPKGSKGSSGPAGTKGDTGSLGPPGPPGPPGEVIQPLPIQSPKKTKRS
SDMQSDAAIMDYGEGMEDIFGSLNNLKQDIERMKYPMGTQNNPARTCKDLQLCHPEFPDG
EYWIDPNQGCSGDSFKVFCNFTAGGETCIYPDKKSNGVRISSWPKEVPGTWFSEFKRGKI
LSYVDVDGSSINMVQMTFLRLLTASARQNFTYSCHQSVAWHDATSDSYDKAMRFLGANDE
EMSYDNNPYIKALSDGCATRKGYGKTVMEINTPKIDQVPIIDVMLTDFGDPNQKFGFEVG
PVCFLG
Download sequence
Identical sequences G3NBF5
ENSGACP00000002652 ENSGACP00000002652 69293.ENSGACP00000002652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]