SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000002952 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000002952
Domain Number 1 Region: 976-1044
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.79e-20
Family TB module/8-cys domain 0.0000481
Further Details:      
 
Domain Number 2 Region: 342-407
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.06e-17
Family TB module/8-cys domain 0.0006
Further Details:      
 
Domain Number 3 Region: 751-882
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000251
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 1158-1218
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000262
Family TB module/8-cys domain 0.001
Further Details:      
 
Domain Number 5 Region: 836-962
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000102
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 225-294
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000144
Family TB module/8-cys domain 0.0037
Further Details:      
 
Domain Number 7 Region: 525-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000148
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 8 Region: 290-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000189
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 9 Region: 1254-1300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000377
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 1099-1146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000379
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 11 Region: 565-608
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 12 Region: 1285-1335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000128
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 13 Region: 1066-1111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000107
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 73-106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000299
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000002952
Sequence length 1350
Comment (Gasterosteus aculeatus)
Sequence
LSLPLFISAMLCSAVGNHTGRIKVVFTPTICKLTCIGGRCHNNCELGNTTTIISENGHAT
DTLTAPNFRVVVCHLPCMNGGKCSTRDKCQCPPNFTGKFCQMSVQNGHQQTSAGYNRAHV
HSTQTLPLTYSNGQNPAKRFSPSLVNIHIKHPPEASVQVHQVSQLDNYQSNGHQLKDSQS
GSSSSTSYTYHNTQSSQKIQHHGYNIVYPGQHGYQVPQYQPVSKNTLGRCFQETAGSQCG
KALPGLTKQDQCCGTIGTSWGFHKCQKCPKEACKKQNYNLLADCPQGYRRINSTHCQDFD
ECQLQGVCPNGNCLNTVGSYRCMCKPGYVPDPTLTTCITNTAIQEEKGACFRLVSSGRQC
LHPVSTMLSKQLCCCSVGKAWGPRCDKCPPPGTDHFKGICPGGMGYTVLPNPPVNKPVIK
YQNPNDPLPPQPLPTPERPVEAFGKPEGIIPVATTAPDQDLVGPMVSNRPVVEPIQPQLS
PGVSTVRIEAAFPEVVERSSPPTPVEILPSNAGQDIAPTQSADAEVDECQINPYICGQGI
CYNTAEGYTCHCDEGYQLDDTQTTCVDVDECLGSTSLCFGGRCKNTEGSFLCECRLGFLV
TEEGTSCFGTYPQLAPYTCNRKGCNENECSSFSALQNGICFIHIECTLRFPLICTSPEMS
NSGPSHHWSKCQEAFWGTGQVWSSRPQVAGTAIQFKPPQITHVECFTDCCRGSACLHCCY
DYIELKYLTLNILFNYTISFSSTLRFLSDIDECQDQRVCTRGHCQNTEGSFICHCAPGFR
VSRAGDHCDDVDECLEEPGSCEAVGECVNNMGSYTCTCPRGYRQINGTSCRDVDECVEEP
EFCSPHGECLNTEGSYLCVCESGFTASLDTPSCDDIDECGLNETLCGPGGFCVNRLGSFQ
CLCEQGYQESQDGKDCVEVNECELRGSVCGEAQCVNVEGSFLCMCPSGQEYNVMIAKCEP
VPTGDPCSAVQMTLPSVERKECYYRLNDENLCESVLISHVTLQECCCTLGAGWGDNCEVH
PCPVNGTVHFNEMCPYGSGFLPNGDLLYGVPTSDSYKDADECTLFGKEVCKGGFCSNTVG
SYECYCKMGQDYDAVKLECRDIDECLDESACAGGQCLNTDGSYMCFCTHPMSLDPTSNSC
VFIPEVVEEHEAEQIDYLGICWQAVTETMTCTRPLGPNRKTTYTECCCLHGEAWGMDCAL
CPPRNTEDYASMCNVGGRQVYGRDALVAGPVHEYESYPTADRLKAFEGLRAEECGILNGC
ENGRCVRVQEGYTCDCFDGYTLDLSRMACVDVNECSELNNRMSLCRNAKCINTMGSYQCV
CLPGFTASARPNYCVAAAPHQTSTHSGSVD
Download sequence
Identical sequences G3NCA3
ENSGACP00000002952 69293.ENSGACP00000002952 ENSGACP00000002952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]