SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000003530 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000003530
Domain Number 1 Region: 366-462
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-26
Family SH2 domain 0.00049
Further Details:      
 
Domain Number 2 Region: 498-536
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000126
Family SOCS box-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000003530
Sequence length 536
Comment (Gasterosteus aculeatus)
Sequence
MKKISLKTIRKSLSIKGKEEGDFVMLQQPSVTPEFSKDESLFGGCYTKELSGCDLGSEED
KGSQNKSRSKSESLMGSLKRRLSTKQKAKVKGSPSAIGSVDDDDAFSSSSVPISFNEVKA
QRPLRSASLRSHHYSPSPWPLRSVNSDEACIKMEVKVKAMVHSPSPSPNLHSVRKEFHDF
QMEGLFQDQAESLKNLQQPQNGELHLDIDENDVPVVLGLTPQDYIQYTMPLDEGMYPEGS
HSFCLDSSSPMEVGTEADNASLHTDQGQEEHELVCGVPPDLFMETSVNGLLLGSAAVMLQ
SSRLEVQPPLSPLLSPMIRNGHIPRTFSGFSSSDSQVAERVRHHLNFDPNSAPGVSRVYD
SVQTSGPMVVTSLTEELKKLARQGWYWGPITRWEAEEKLINLADGSFLVRDSSDDRYLLS
LSFRSQGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIIDSENGAFCYSRSRLPG
SATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIRKLPLPNKMKDYLQEKHY
Download sequence
Identical sequences A9LDS0
69293.ENSGACP00000003530 ENSGACP00000003530 ENSGACP00000003530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]