SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000004488 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000004488
Domain Number 1 Region: 48-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000126
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000000327
Family Hairy Orange domain 0.0000692
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000004488
Sequence length 285
Comment (Gasterosteus aculeatus)
Sequence
MKRNHDFSSSDSELDETIEVEKESADENGMSSPLGSMSPTTTTTQVQARKRRRGIIEKRR
RDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHAAGGKGYFDAHALAMD
YRGLGFRECLAETARYLSIIEGLDSADPLRIRLVSHLNNYASQREAHSGLSHLAWGSAFG
SPPAHLTHPLLLQHQQGAPLAALTRSTTSSPQTPLSSTSTSSPSSSSSSFLVGCRDSRAG
PAQRQRHLSPGSRSDPSARHHRGSRQRGHTRACVLVGSKLSPPLL
Download sequence
Identical sequences G3NGN2
69293.ENSGACP00000004488 ENSGACP00000004488 ENSGACP00000004488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]