SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000005510 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000005510
Domain Number 1 Region: 302-392,422-532
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00000288
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0065
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000005510
Domain Number - Region: 3-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000879
Family Laminin-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000005510
Sequence length 555
Comment (Gasterosteus aculeatus)
Sequence
MAQCDRLTGACECREGAAGKRCDECARGFTGDFPSCVQCHPCFQLWDDAVCQIKRDLEHI
QYTAQKILESGVMPDIGDTRIRELEMKLLEVQDLISSEDGDRIHQLIGQSIDDLRAEIAL
TDGRLMGVAREINSTSEEESELRRTLSDLEQQLRDVNATVAHKQRVLDDFLTSGFADQFE
KVKKYYQESLTAEDKCDASVSGPLSPVEQSKTSRAVTENLLNATRDNFLRALAAQNKSLS
ELQQKDLDLDKKVHHLSHKVCGGHSNASVNGSCPHSRCGGAGCRDDQGNPACGGDECNGT
VSTSVRALTLARNATDRVSAANEELQGVARKLQDIATLTQDVKNQAMNTLEKVQKKKDQF
ENNNKKLKDFIKKIRDFLTEEGADPESIEKVALQVLAITLPANTTTLDKMVMRIKDRLSN
LTDVEGIVNQTAQHIRKAKELLTEAEEAKSRAEGVKDTANSTKQALDESEKAIKEATDAL
TEAHDNLNSTRNATFEVAERLRQLEEKQDDVMTRLNNLTAEVEALRNKTEQNRQMAKDAK
ALASNATREASSLEQ
Download sequence
Identical sequences G3NJJ9
ENSGACP00000005510 ENSGACP00000005510 69293.ENSGACP00000005510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]