SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000005778 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000005778
Domain Number 1 Region: 26-159
Classification Level Classification E-value
Superfamily C-type lectin-like 2e-17
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 2 Region: 324-432
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000005778
Domain Number - Region: 244-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00015
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 286-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00642
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000005778
Sequence length 491
Comment (Gasterosteus aculeatus)
Sequence
VITVLLLLYISPDTRGAAQMEPCRARCSGTRCFAAFHRAADSTAARDGCADLGGHLMTVR
SSSIHDILPFLLGNLTGRFWIGLHLATGCPDPAAELRGFRWATGEVGSEFTHWPAAFDGS
CSSPRCVSVSQEDDFEWVQGPCGDRLAGFLCEHGLGDPCEARTDARGAAPVYTPAAGSSP
PGSTAVRTPPDTKYFCVSGRWQPAPRSCGAHEGVCERRCAENPERAPSPDPPTGTDDPCV
ALDCAQGCHKDGRASACTCGHGFKLARDGRSCVHVDDCADERRCTGENSVCVSNSVGGSR
CVCEDGYKSRSGRCVDVDECASAPCEHKCANTPGSYECGCFPGYKKDPKSPHTCALFCGE
EECAAECDPNNRFQCFCPDGYVADERGGDTVCTDIDECSSDYCDDLCRNTFGSYVCACSP
GYTLVDQFRCVKNEGPTDEEPEGSGEATSQSFPTTTTATARPEPPRRPSAVSAGGLAGII
VCTVFFSLLML
Download sequence
Identical sequences G3NKB6
ENSGACP00000005778 69293.ENSGACP00000005778 ENSGACP00000005778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]