SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000006381 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000006381
Domain Number 1 Region: 804-933
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.67e-32
Family Synaptotagmin-like (S variant) 0.00000112
Further Details:      
 
Domain Number 2 Region: 24-66,120-191
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.69e-24
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0089
Further Details:      
 
Domain Number 3 Region: 1363-1485
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.46e-22
Family Synaptotagmin-like (S variant) 0.0048
Further Details:      
 
Domain Number 4 Region: 636-757
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-20
Family PDZ domain 0.00000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000006381
Sequence length 1513
Comment (Gasterosteus aculeatus)
Sequence
MSAPHGPRGGPSAAGAMPEMPDLSHLTEDERKIILGVMDRQKKEEAKEQTMLKRRRRERA
GSGQWPYPWSGRLLGWPALMQPDQRKNQRLQPAQKLHQQFESYKDQVKKMGEETKPTQEL
KSEAPTCGICHKTKFADGCGHLCSYCQTKFCARCGGRVSLRSNKVMWVCNLCRKQQEILT
KSGAWFFDPGPGQVRGVFEGGPQGKKAKLQDPSLYPYQGASGDLTDRSRPHGGLLPRQAS
LDNGAGLRYSAPGDAPIDRKQSPSASRDPNQKYDQREGVDHSQYAPTDGGMPRSPSDYGD
GDHRRAPRGPHMYPDAEAARMGYRGPGRWHSQEYPLDQELDGPPSEYDLQRQRQEEFQTR
YRSDPNLARYPVKPQPYEEQMRMHAEVGRVRHERRHSDVSLAYTEQDDPGPVRLSRQHLT
ERRPPMVGQRSYSVDRSSPGPMGPGLGGHRTSNHSPPTPHRSPVLGDRSGDLRRGDLGVG
GDSMRRQQHHLDPSSAVRKTKREKMESMLRNDSLSSDQSESVRPPPPKPHKTKKGGKMRQ
VSLSSSEEELATTPEYTSCEDVEIESESVSEKGDSQRGKRKTIEQTYMSEPTHTLSERQK
KMVRFGGHSFEEDLAWCEPQVKDSGVDTCSSTTLNEEHSHSEKHPVTWQPSKDGDRLIGR
ILLNKRMKDGSVPRDSGALLGLKVVGGKMTESGRLCAFITKVRKGSLADTVGHLRPGDQV
LEWNGKLLQGATFKEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFES
QKMDRPSISVTSPMSPSMLRDAPQYLSGQLSVKLWYDKVGHQLIVTILGAKDLPAREDGR
PRNPYVKIYFLPDRSDKSKRRTKTVKKSLEPKWNQTFMYSPVHRREFRERMLEITLWDQA
RVREEESEFLGEILIELETALLDDEPHWYKLQTHDVSSIPLPRASPNTQRRQLHGESPTR
RLQRSQRISDSEISDYDCEDGVGVITDYRPNGRDFQSSTLSVPEQVMSSNHCSRSADINR
ARSRSPSVPPPSSRSLDQAFDLRPSQYSSSARVDHHSVSEDNYSPDSRGRAHPRSGSVQT
SPTSTPASNRRGRQLPQLPPTGKDRNSCMDMEERTRQMKLKMNKYKQGAGSDPRLEQDYH
KEYRSGRDPRASDNLSAKSSDSDVSDVSAVSRTSSASRFSSTSYMSVQSERPQGNRKIRD
FASKMKNRQMGSSGGVNMTKSTSVSGDMCNLEKTDGSQSDTAVGTVGTDDKKRRSSIGAK
MQAMVGMSRKSRSTSQLSQTETGGKKLRKEIHRSTETGLAMEMRSRMTRQASREYTDGSM
NSYSSEGNLIFPGVRLSSEAQFSDFLDGLGPAQLVGRQTLATPPMGDIQIGMVDKKGALE
VEIIRARGLVGKPGSKALPAPYVKVYLLENGVCIAKKKTKVARKTLDPLYQQQLPFEESP
GGKVLQVIVWGDYGRMDHKSFMGAVQILLDELDLSNMVIGWFKLFPPSSLVDPTLAPLTR
RASQSSLDSFSRS
Download sequence
Identical sequences G3NM18
ENSGACP00000006381 69293.ENSGACP00000006381 ENSGACP00000006381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]