SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000007495 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000007495
Domain Number 1 Region: 78-651
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.14e-180
Family Myeloperoxidase-like 0.000000000359
Further Details:      
 
Domain Number 2 Region: 659-714
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000139
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000007495
Sequence length 734
Comment (Gasterosteus aculeatus)
Sequence
AAPTWLRQSEPETREVTQAAEVFHATLQVLESTARPRYERDVTAPEPLSWEDVELIAELS
KCPPVPHPAACLQSPLDKYRSISGLCNNRQNPLWGAANTPLVRWLPAEYEDGEREPKGWN
RGRLHNGFQLPPPWEVSQKIIRSSTKETDGVYSHLLVEWGQYIDHDVTFTPQSKDYAGFG
TGADCSNTCQNVHPCFPIETGASVSGARSCMPFHRSAPACPVGPGPDVPRARRRQQMNAI
TSFIDASPVYGHTPRRGALLRDLSGRSGKLAVNERFRDPGGRAYLPFASALPSACLQTPR
GERVECFGAGDGRANEGLPLASLHTLWLREHNRMAGELRRVNAHWSPETVYQEARKVVGA
LHQIITMRDYVPKIIGQAAFDSYIGPYRGYDPATDPSASNVFATAAFRFGHATIPPVLRR
LNESFQTHEHFGDLRLHQTFFSPWRIVKEGGIEPILRGAFGTAASAGSADMLLTEEITER
LVVLNLPRPMDLASLNLQRGRDHALPGYNDWRSFCGLERIKDMEGLKGVVRDHAVAEKMA
RIYKHPDNVDVWLGGLVEHMPPGSRTGPLFACLIGKQMKALRDGDRFWWEAEGVFSQRQR
AQLLKASLSRIICDNSDIREVPPDSFRFGRYPYDYIPCDRVPSIDLEAWQEETDHDMEQC
GIPRMIKNGDFILSSTNGKLVALYSCYHGFKLKGAAAVVCQGNQWSDQPPQCTAKGRSAF
CRWTCMGIALVLTG
Download sequence
Identical sequences G3NQ79
ENSGACP00000007495 69293.ENSGACP00000007495 ENSGACP00000007495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]