SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000008017 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000008017
Domain Number 1 Region: 193-392
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.63e-28
Family Laminin G-like module 0.0076
Further Details:      
 
Domain Number 2 Region: 1-119
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-18
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 133-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000786
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000008017
Sequence length 400
Comment (Gasterosteus aculeatus)
Sequence
DFFCLSLTSGFVQLRYNLGDGTHVLRSAQRVDPHGGTWHTVKAGRVGPRGFLSLDDREET
GDNATGGMSTLDVATDIFVGGVSALSAVSPDAISGEPLGFTGGLRELLINGEELELTETG
AASGANVGDWDGTACGYKVCRNGGRCAATGSGAFTCRCPPPWTGSACDQSVGCASNACAR
GSLCAASGARSYRCICPLGRGGRRCDAEVPADTLRFVGSSYVKHSDARYSARNVKHARVS
FSFVARAGDGVIAWMGRAEREDDDYLAVGLEDGRLKIAVNLGEELAAPVALRNLTLCCGT
WHNVSVWLNGTIVQVFVDLRRVLSEDLDPFERYVALNYGGRLYFGGFELHRNVSIVTSGL
FSKGFEGSLRNVYLFKDTKPLQFLNNSEGFNVYDEELEVI
Download sequence
Identical sequences G3NRQ0
69293.ENSGACP00000008017 ENSGACP00000008017 ENSGACP00000008017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]