SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000008055 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000008055
Domain Number 1 Region: 31-106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000581
Family Growth factor receptor domain 0.0039
Further Details:      
 
Domain Number 2 Region: 100-165
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000398
Family Fibronectin type I module 0.033
Further Details:      
 
Domain Number 3 Region: 235-280
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000119
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000008055
Sequence length 389
Comment (Gasterosteus aculeatus)
Sequence
WESADSMGILILLAVFQLATFGLVTAGCPVVCECPAGPASCPPGVSSVLDGCGCCKVCAA
QLNQDCHEGRPCDHHRGLECNYGNDVGHTHGICRAKAEGRSCEYNGRIHQNGENFNAGCK
HQCTCIDGAVGCVPLCPSHVPLASPSCPAPHLVKVPGQCCLTIDCYRGATAVPKREKDVL
GNELVEAGRKRDKPRGNKHLAEVLSHSTYLCHPAFPSLYRPLYASVLPVWRKVGDQCVVQ
TTSWSQCSRSCGMGVSSRVTNDNARCKLIKETRLCNVRPCSSMSIPVKKGRKCSRTHKAP
EPHRLSYAGCRSTRLYRPNYCGVCRDGRCCSPRRTRTAGVAFACPDGERFSRSVMFIQSC
KCSDECNHLNEAAMPPQQWLYGDTHKFID
Download sequence
Identical sequences G3NRT8
ENSGACP00000008055 69293.ENSGACP00000008055 ENSGACP00000008055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]