SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000008333 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000008333
Domain Number 1 Region: 18-124
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-31
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 2 Region: 194-255
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000432
Family Spermadhesin, CUB domain 0.0039
Further Details:      
 
Domain Number 3 Region: 130-195
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000125
Family Complement control module/SCR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000008333
Sequence length 259
Comment (Gasterosteus aculeatus)
Sequence
LLIMTVCFPLFPGFIHTCGGTLKGRNGTIESPGFPYGYPNGANCTWVIVAEEGSRIHIVF
KSFAVEEEYDFLSLYDGHPHPANFRTRLTGFTIPAPVTSSGSIFSLRLTSDFAVSAHGFK
VAYEELRSSSCGNPGVPPKGILNGTQFNVGGKIRYRCVTGYVLDGHSLLTCVTTAAGVSV
WDFPVPICRAEDTCGGTLRGSSGLISSFDIPSSLGTSGECKWTILADPGDTISLVFTEFQ
MEEKSDYLEVEGSEPTTIW
Download sequence
Identical sequences G3NSL5
69293.ENSGACP00000008333 ENSGACP00000008333 ENSGACP00000008333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]