SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000008413 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000008413
Domain Number 1 Region: 199-397
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.83e-47
Family Reprolysin-like 0.00033
Further Details:      
 
Domain Number 2 Region: 414-490
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 3.01e-18
Family Blood coagulation inhibitor (disintegrin) 0.00056
Further Details:      
 
Domain Number 3 Region: 647-679
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000318
Family Integrin beta EGF-like domains 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000008413
Sequence length 737
Comment (Gasterosteus aculeatus)
Sequence
PPAEELVQPKRLLLRRIHSEEELLHGRLDTRVKNYTAEAQPVHVAHSSFLVEAFGKSFVL
DLELNHNLLSRDYVERHYDENGQLSQNKGGEHCYYHGRVRGRPGSWAALSTCHGLRGMFS
DGNVSYGIEPVGSGQDHNDHVVYRVPDVDLFPTPCPVNPCCPPPSTWQVPAAGLKLIFPG
KFSPKKKVRRGQRTVQTETKYIELMVVNDHELFVQLRRSATQTKNFAKAVVNMADAIYKE
QLNTRIVLVAMETWSSENKVSVGEDALLTLRDFMKYRKESIKERCDAVHLFSGRTFMSSR
SEAAYIGGICSVSRGGGINEFGSVGPMAITLSQSLGQNIGMLRNKERLAAGDCRCPDPWL
GCIMEDTGYYLPRKFSRCSIDEYLRFLQVGGGSCLFNKPSKLLDPPECGNGFVEPGEECD
CGSLVECARNGANCCKKCTLTHNAMCSNGLCCRDCRYELRGVTCREAVNDCDIPEACMGD
SSQCPHNVHKLDGYTCEAGQGRCYGGRCKTRDGQCRTLWGYNSADRFCYEKLNSEGTEKG
NCGPDSSGQGWVQCNKQDVLCGLLLCTNLTERPRFGELQGKVTSLTIHHQNRYLDCRGGH
AVLDDGLDMGYVEDGAPCGPNMMCSERRCLPVTTFNLSTCPGSSASASRICSHHGTCSNE
VKCICDPDYTGKDCSVFDPILVPTPADGPEKYKGPSGTNIIIGSVAGAILVAAIVLGGTG
WGFKNIRRGRYDPAFQS
Download sequence
Identical sequences G3NSU5
69293.ENSGACP00000008413 ENSGACP00000008413 ENSGACP00000008413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]