SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000008970 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000008970
Domain Number 1 Region: 565-642,677-893
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.56e-80
Family Protein kinases, catalytic subunit 0.00000000236
Further Details:      
 
Domain Number 2 Region: 1-150
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.08e-64
Family Ephrin receptor ligand binding domain 0.00000426
Further Details:      
 
Domain Number 3 Region: 275-480
Classification Level Classification E-value
Superfamily Fibronectin type III 3.41e-31
Family Fibronectin type III 0.00022
Further Details:      
 
Domain Number 4 Region: 895-964
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.91e-18
Family SAM (sterile alpha motif) domain 0.00051
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000008970
Domain Number - Region: 204-264
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00251
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000008970
Sequence length 972
Comment (Gasterosteus aculeatus)
Sequence
WDAITEMDEHNRPIHTFQVCNVMEPNQNNWLRSNWISRQAAQKIYVELRFTLRDCNSIPW
VSGTCKETFNLFYHETDESHSVKFKPPQYTKIDTIAADESFTQMDLGDRILKLNTEVREV
GPMTRKGFYLAFQDIGACIALVSVRVYYKKCPFTLRNLASFPDTVPRVDSSSLVEVRGAC
VDHAEERDTPKLFCGADGDWLVPLGRCVCSVAYEEVDGACAACHPGFYKAYAGNTKCSKC
PPHSVSYGEGAAACRCETSFFRAERDPPTMACTRPPSAPRNVMSNLNDTCLVLEWSPPGD
TGGRWDVTYNVQCKRCGPGPEQCHFCEEELRFLPRPLGLTNATVTVMDFSAHANYTFEIE
SLNGVSELSSFPRQVAVITVSTDQGGPSLVGTLKKDWASPNSIALSWQQPEQTTQLILDY
EIKYYEKEHEQLSYSSTRTKAPSVIISGLKPATWYVFSVRSRTPAGYSSYTPKYEYKTAG
DSSDLASDQGQVLVIVTAAVGGFTLLVILTLFLLITGRCQWYFKAKMSTEEKRRTDYQNG
QVPFPGIKTYVDPDTYEDPTQAVHEFTKEIDPSRIRIERVIGAGEFGEVCSGRLRTPGKK
EIAVAIKTLKGGYVERQRRDFLREASIMGQFDHPNIIRLEGVVTKIFLPCCHLISVCTSL
GVNNILAITTNNTLLKMIAGRPVMIVVEYVENGSLDSFLRQHDGHFTVIQLVGMLRGIAS
GMKYLSDMGYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEAAYTTTGGKIPIRWTA
PEAISYRKFSSASDAWSYGIVMWEVMSYGERPYWEMSNQDVILSIEEGYRLPAPMGCPVA
LHQLMLHCWQKERSHRPKFTDVVSFLDKLIRNPSSLLPLVEDIQSLPESPGEEMDYPMFI
SIGDWLDAIKMSQYKSNFMAAGYNTLDSVARMSIEDVRRIGVELIGHQRRISSSVQTLRL
QLLHEQEKGFHV
Download sequence
Identical sequences G3NUF2
ENSGACP00000008970 ENSGACP00000008970 69293.ENSGACP00000008970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]