SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000009398 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000009398
Domain Number 1 Region: 315-474
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.59e-56
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000205
Further Details:      
 
Domain Number 2 Region: 147-307
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.81e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000705
Further Details:      
 
Domain Number 3 Region: 109-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000282
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 25-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 66-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000219
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000009398
Sequence length 475
Comment (Gasterosteus aculeatus)
Sequence
MKEQTRLVLWLQLFSACLVFGVNGDYCKVNVCINGGTCVTGAGTPYICICPDGFTGDICN
ETETEGPCNPNPCRNDAICELTGQTRRGDVFSEYVCKCQSGFDGVHCQNNVNDCDSQPCG
NGGTCRDLEGDFKCNCPSPYVGKRCQLRCISLLGMEGGGIAESQISASSVRYSMLGLQRW
GPELGRLHNKGLVNAWSAAAHDKNPWMEINMLRKMRFTGIVMQGASRIGTAEFIRSFKVA
YSLDGRTYTMYRTNGQRRDNVFVGNVDNDSTKTNLFDPPIIAQYIRIIPVVCRKACTMRM
ELVGCELNVYSNTSGCSEPMGMKSRLVSNGQITSSSTFRTWGLEAFTWHPHYARLDKQGK
TNAWTAATNSRAEWLQVDLGSPKKITGVITQGAKDFGSIQFVTAFKLAHSDDGRSWTIVK
DERTGADKIFPGNSDNNVHKTNIFEPSFYSRYVRILPWEWHERITLRMELLGCDE
Download sequence
Identical sequences G3NVM9
ENSGACP00000009398 69293.ENSGACP00000009398 ENSGACP00000009398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]