SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000010321 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000010321
Domain Number 1 Region: 868-1170
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.21e-87
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000591
Further Details:      
 
Domain Number 2 Region: 1131-1433
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.99e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000107
Further Details:      
 
Domain Number 3 Region: 22-182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.17e-39
Family MAM domain 0.00000646
Further Details:      
 
Domain Number 4 Region: 385-584
Classification Level Classification E-value
Superfamily Fibronectin type III 2.41e-24
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 5 Region: 280-416
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000698
Family Fibronectin type III 0.0078
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000010321
Domain Number - Region: 186-287
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00041
Family I set domains 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000010321
Sequence length 1436
Comment (Gasterosteus aculeatus)
Sequence
TCGYCVIFTPQVCSSSSSLTAAGCTFDEDSDPGLCEYRQGQDDDFDWQLIRTYNWPHPTP
DLLRGSFMMVNSSQHFGGQRAQLLLLPLSENDTHCIQFSYFLYSRDGHSPGDLQVYIRVN
GGPKGSAVWNISGSQGRQWHQVELAVSTFWPSEYQVIFEATVSQERQGYIALDDIVLLNY
PCYKVPHFARLGDVEVNAGQNASFQCVATGKVSETEPFLLERRYSMVVDDSSLSRLSHKR
LMASFHVEAQRGEQDLYRCITLSPRGAAVSNFGELIVRVPPTPIAPPQLLRAGPTYLIIQ
LNTNSIVGDGPVIRREIQYRASQSTWTETHGVGSLTYKIWHLEPDTEYRISVLLTRPGDG
GTGAPGPPLTSRTKCAEPMRALRGLTAAEIQPRQLALQWEPLGYNLTRCHTYSLSLCYRY
SMPTGGSGGNNATVRECLSVDRNTSHFSLRDLPPFRPVHVRLALANPEGKKESREVTFQT
EEDIPGGIASESLTFTPLDDMIFLKWEEPVEPNGLITQYEISYQSIESSDPGINVPGPRR
TVSKLRNETYHMFSGLHPGTTYLVSVRARTAKGFGQTALTEIITNISAPVFDYEDVPSPL
SESESTITVLLRPALARGAPVSAYQVVVVEEDGSRQVRRRELGTADCFPAPKSHGEAQAR
GTPHYYTAELAPSSLPEATPFTVGDNHTYNGYWNSPLDPTKNYLVYFQATSNFRGETRIN
CIRIARKAACKDSKRALEVSQHAEDMGLILGACAGGLAVLVLLLGAIVVIVKKGRQLLIH
YSNEYYSLGKSHSHKRSETAARRKQEQTCLFLAHPDIVTHIQSECVHEQRSSVNESSSLL
GGSPHRHCRRKSSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYESFFDGWDVTKK
KDKTKGRHDSLLNHDRHRVKLHSLLADPSSDYVNANYIDGYQRSNHFIATQAGPKQEMIY
DFWRMVWQENCFSIVMITKLVEVGRMKCCKYWPDDTELYGDIKITLLKTETLAEYTVRTF
AMERRGYPAKHEVCQFHFTSWPEHGVPYHATGLLSFLRRVKASTPPDGGPVVVHCSMGAG
RTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRINMIQTEEQYVFIHDAILEACLCGET
SVPVNEFVLTYKEMLKVDSQSNTSQLREEFQTLNSVTPHLDVEECSISLMPRNREKNRSM
DVLPPDRSLAFLVTTEGESSNYINAALADSFLRPAAFVVTPHPLPGTTTDFWRLLYDYGC
TSVVMLNQLNQSNSAWPCLQYWPEPGLQQFGPMTVELLSRTADDDIIIRLFRVQNITRIQ
EGQLVVRHFQFLRWSPYRDVPDSKKAFLSLLAQVHNWQMECGEGRTIVHCLNGGGRSGTF
CASTMILEMIRHHSMVDVFFAAKTLRNSKPNMVETMEQYRFCYDLAQEYLDCLEVR
Download sequence
Identical sequences G3NYA1
ENSGACP00000010321 ENSGACP00000010321 69293.ENSGACP00000010321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]