SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000011322 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000011322
Domain Number 1 Region: 497-712
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-103
Family Thrombospondin C-terminal domain 0.0000000957
Further Details:      
 
Domain Number 2 Region: 370-495
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.14e-34
Family TSP type-3 repeat 0.00000494
Further Details:      
 
Domain Number 3 Region: 302-372
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000497
Family TSP type-3 repeat 0.00023
Further Details:      
 
Domain Number 4 Region: 225-313
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000222
Family TSP type-3 repeat 0.00017
Further Details:      
 
Domain Number 5 Region: 2-40
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000235
Family Assembly domain of cartilage oligomeric matrix protein 0.0009
Further Details:      
 
Domain Number 6 Region: 86-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000052
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000011322
Domain Number - Region: 137-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000569
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 199-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00138
Family EGF-type module 0.081
Further Details:      
 
Domain Number - Region: 55-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00513
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000011322
Sequence length 729
Comment (Gasterosteus aculeatus)
Sequence
EIISQIKMTNMALAEIKELLSQQIKEVVFLKNSVMECEACASLFSAMGGIQPRPSCVPNP
CHPGVKCKETPQGVKCGDCPDGMEGDGAHCTDVDECAAMPCHMGVRCINTSPGFRCGSCP
AGYTGPQVQGSGLAYATANKQVCKDINECEGLNNGGCVENSVCMNTPGSFRCGPCKTGYV
GDQRRGCKPERACGNGQPNPCHASAECIVHREGTIECQCGVGWAGNGYLCGADIDIDGFP
DERLACPERSCNKDNCLTVPNSGQEDADGDGLGDACDEDADGDGILNMQDNCVLVPNVDQ
RNIDEDDFGDACDNCRAIKNNDQKDTDVDKSGDECDEDLDGDGILNQLDNCKRVPNADQK
DRDGDKVGDACDSCPYVPNPEQTDVDNDLIGDPCDTNKDSDGDGHQDSRDNCPAVINSSQ
LDTDKDGAGDECDDDDDDDGVPDLLPPGPDNCRLIPNPLQEDSNGDGVGDICEKDFDNDT
IVDTIDVCPENAEVTLTDFREYQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAV
GYTAFSGVDFEGTFHVNTETDDDYAGFIFGYQDSSSFYVVMWKQVEQVYWRPNPLRAVAE
PGIQLKAVKSDTGPGENLRNALWHTGDTSEQVKLLWKDARNVGWKDKTSYRWFLQHRPAD
GYIRVRFYEGPKMVADTGVIIDSTMRGGRLGVFCFSQENIIWANLRYRCNDTLPEDFDTY
RAEQVRLAT
Download sequence
Identical sequences G3P149
ENSGACP00000011322 69293.ENSGACP00000011322 ENSGACP00000011322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]