SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000013073 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000013073
Domain Number 1 Region: 286-338
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000632
Family UBA domain 0.0098
Further Details:      
 
Domain Number 2 Region: 14-197
Classification Level Classification E-value
Superfamily Rhomboid-like 0.000000000144
Family Rhomboid-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000013073
Sequence length 338
Comment (Gasterosteus aculeatus)
Sequence
MFTTTGSRGLYKAPLSKGLLLVLSGLTVMLALLPQYQELFVYDLQAVTQHHRLWSLLFGR
LVCLDVKDSFCSALLIYNFRIFERRFGSRKFASFLLATWCLSALTDFLLARAFRSLFDYE
VEELPAGLLAPVFALFVPFYRLIPRVPVTQVLGQIHITNKSLVYIVGLQLLTSSPFMWLL
ALSGLIAGGLYHSNVLWMQKLIFVPACVSFIGRNILEPIFSSAQPSGEAPLGMGATLDIQ
RQQRMDVLDQQLLLAQYNESTRNNRPQPPSGLFGWTRLFSTLRQRGQNRPPVQPPPQAQF
VPQVALLVEMGFSRSDALEALRASNNDINAATNFLLQH
Download sequence
Identical sequences G3P650
ENSGACP00000013073 ENSGACP00000013073 69293.ENSGACP00000013073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]