SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000013853 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000013853
Domain Number 1 Region: 979-1274
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-80
Family Protein kinases, catalytic subunit 0.000000000325
Further Details:      
 
Domain Number 2 Region: 338-498
Classification Level Classification E-value
Superfamily L domain-like 9.36e-49
Family L domain 0.000000847
Further Details:      
 
Domain Number 3 Region: 32-190
Classification Level Classification E-value
Superfamily L domain-like 5.1e-42
Family L domain 0.00000118
Further Details:      
 
Domain Number 4 Region: 501-620
Classification Level Classification E-value
Superfamily Fibronectin type III 4.92e-30
Family Fibronectin type III 0.000004
Further Details:      
 
Domain Number 5 Region: 790-938
Classification Level Classification E-value
Superfamily Fibronectin type III 1.38e-20
Family Fibronectin type III 0.00017
Further Details:      
 
Domain Number 6 Region: 624-703,796-816
Classification Level Classification E-value
Superfamily Fibronectin type III 3.33e-19
Family Fibronectin type III 0.00019
Further Details:      
 
Domain Number 7 Region: 172-340
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000817
Family Growth factor receptor domain 0.00000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000013853
Sequence length 1366
Comment (Gasterosteus aculeatus)
Sequence
MRRWTLRLRAQIVCFIVGTCIVFQCGLIHGEICQSKDIRNNVTNLQSVENCTIIEGHLKI
LLMFKTKTEDFRGLSYPRLQVVTDYVLLFRVYGLEALTDLFPNLAVIRGNNLFFNYALVI
YEMLQLKEVGLHSLMNITRGAVRIEKNPDLCYLATLDWSKVLDSVEDNFIVDNKNDRECG
DVCPGTAQGQTTCPQNTINGHFRSRCWSQNHCQRMCLDNCRHSACNHKGQCCHDQCLGGC
SEPGNASSCVACRNLQHGNNCMEKCPPGYYVFRGWRCVSFSFCQQELHNQCKDSKKLNQD
RELGCHEYVIHNGACIPECPSGYTTINSTTLTCSPCAGLCPKLCAGNKTIDSVTSAQALR
GCTVLHGNMIIKIRGGNNIAAELEASLGQLEEITGHLTVRRAYALVSLSFLRKLRVIRGE
HLEGDVFAFYALDNQNLHELWDWSKHNLTIHHGRMFFHYNSKLCMSEIRKMENVTGTKER
NQKNDIAVRTNGDQASCVTKLLKFTLIKTSSNMIMLKWEPFWPSDFRDLLGFMVLYKETL
YRNVTEFDGQDACGSNSWAIADVDPPQRSTEGKKADDPGYLIRPLKPWTLYAIMVKTQLS
TSDEQQVNGAKSKIIYVRTDASKPSVPLDPISSSNSSSQIILKWKPPTNPNGNITHYRVI
CRKQSEDSDLYKFDYCLQGMKLPSRTPTPTVRMNRSGTTQTSPPGRCCACPKTDYQLKKE
QEEIEYRKTFENYLHNEVFESRPSRRRRSVGVANATLPSFFLPAAPGLAFGSTTVPPEDE
EGSKVELKVSSKESTVISNLHHFTSYKIEIIACNKVKDVEQCSLASLVSARTMPEEKADD
IPGTVTHEIVAAEPPYVLIKWDSPRSPNGLIILYEVYYRKVEDTEDLTACVSRPAYLKSG
GTKLSLMHPGNYSVRVRATSLAGNGSFTETTYFYMPNSDPGLIWIVMGPVICFILLLFIG
GGVFVILKKRQTEGPTGPLIASSNPEYISTNDVYIPDEWEVPRDKITVLRELGQGSFGMV
YEGIAKDIIKGDPDTQVAVKTVNESASLRERIEFLNEASVMKAFNCHHVVRLLGVVSKGQ
PTLVVMELMTHGDLKSYLRGLRPDSENNPTGRSPPTLKEMIQMAAEISDGMAYLNAKKFV
HRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAH
SDCWSFGVVLWEITTLAEQPYQGLSNEQVLKFVMDGGYLDRPDNCPERMHSLMQMCWQYN
PKMRPLFQEIIEMLREDLHPSFHDFSFFYSEENKVPETEEYDLDLDNMESIPLDPSSYSQ
REESLGRDSGPSAARRGNYEEHVPYTHMNGGKKNGRILSLPRSSPS
Download sequence
Identical sequences G3P8C9
69293.ENSGACP00000013853 ENSGACP00000013853 ENSGACP00000013853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]