SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000014334 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000014334
Domain Number 1 Region: 426-664,695-769
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.67e-54
Family Diacylglycerol kinase-like 0.014
Further Details:      
 
Domain Number 2 Region: 5-156
Classification Level Classification E-value
Superfamily EF-hand 2.58e-34
Family EF-hand modules in multidomain proteins 0.00046
Further Details:      
 
Domain Number 3 Region: 135-243
Classification Level Classification E-value
Superfamily EF-hand 1.8e-18
Family Calmodulin-like 0.045
Further Details:      
 
Domain Number 4 Region: 223-294
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.37e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 
Domain Number 5 Region: 298-362
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000583
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000014334
Sequence length 790
Comment (Gasterosteus aculeatus)
Sequence
APTQPEVKELNPVDFIQLQQYIEYCRLTVKDVLREFDADGRLARHRHGEGKSDNVNKKQC
INEEGFRLFLKTYLEVEDFPVDLCQRLFCSFQNSEPTHMPVSLHALALFGVASRLPKTVV
DRHRSVSPVEEVFLKDVSCYFSLLEDGQPRDKLEFAFKLYDRDGNGVLDSSEVDRIIAQM
MHAAEYLGWDVSELRPVLKDMMTAIDADSSGTVSLEEWVEGGMNNVPLLVLLGLKVTQKD
GQHLWKMKHFNKPVYCNVCQSMLLGLRKQGLCCTCCKYTVHGRCANRNPAPCTRTYVKSK
KETGVPTHDWVSGNCDSRKCEKCQKKIKSLQGLTGKHCVWCHTMRHDECADQEPTQCTCG
PLRDHILPPWAIYPVIKKPFPPSCVSLKERPNNVKNGGSGAADDSVLNTTPDGQVLQISP
VPNTHPLLVFVNLKSGGKQGERVLHKFQYLLNPRQVHNLCNGGPAPGLSFFRNLQNYRIL
VCGGDGTVGWILDAIDKANLLVRPPVAVLPLGTGNDLARCLRWGGGYDGEDLSRILKDIE
GSSQVLMDRWTVQVIPDENQEKGDPVPYEIINNYFSIGVDASIAHRFHTMREKHPQKFNS
RMKNKLWYFEFATSETISASCKKLSESLTIECCGTPLDLSSLSLEGVAVLNIPSMHGGSN
LWGETKKCEAKGMTSQEEPDVIVDPEILKVTSQGPDLSDRRLEVVGLEGAMEMGQIYTGL
KSAVRLAKTSQITIRVKKALPMQIDGEPWMQPPCTIHITHKNQASMLMAPQAKSVIFVGA
VKMLQKTDKY
Download sequence
Identical sequences G3P9R0
69293.ENSGACP00000014334 ENSGACP00000014334 ENSGACP00000014334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]