SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000016207 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000016207
Domain Number 1 Region: 36-148
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-32
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000625
Further Details:      
 
Domain Number 2 Region: 246-346
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000000719
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 419-475
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000011
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000016207
Sequence length 487
Comment (Gasterosteus aculeatus)
Sequence
INRGRRARGTMSRGSKAKTESVRSSLLSSQENEQLEELMGRRCASTATAVAQLFMALPHS
PSAWSLQHTGVLCFIKDSFQRSYFIRMFDLKTGRMVWEQEIYNQMLYSSPQKYFHTFPAD
DCQVGLNFSAQQEAEAFQDAVEEKINQRQSRQGQKEKKQRPLPPSVSRAVDRASLPPPPP
EKASLGSPGSFQMSTVEIPNPDIQSSRYRSMPSPTASLSLTGKGKKNKKKDKKAPKFSKA
DIGAPSGFKHVSHVGWDPNNIDPDLLNLLSQAGIGEDEMKDEKTSQLILNVIEQSGGMEA
VKREVNRGRQGPLPPVPGSSAPAPPPPRGRSGPLPPVPGQSSRGLPPPARGALPPPPPAT
SRSGLPPPPAHCAPPQFPSAPPPKAPNNLPPPPPPSQQRSSGFPPPPPPSTPPSRGGGGG
ALLDQIRLGKKLRNVIDSPDAPAPESSEGIVGALMSVMQKRSKAIHSSDESEDDGGDDDE
DDDEWDD
Download sequence
Identical sequences G3PF33
ENSGACP00000016207 ENSGACP00000016207 69293.ENSGACP00000016207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]