SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000017022 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000017022
Domain Number 1 Region: 131-456
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.16e-60
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000154
Further Details:      
 
Domain Number 2 Region: 460-597
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.53e-20
Family Ricin B-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000017022
Sequence length 600
Comment (Gasterosteus aculeatus)
Sequence
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSEELIQIGRMSDQRLRARTGKVSNLVD
RQSILQRLERLEDVVYNQLNGLAKPMGLVEGPGGLGQGGAAATLGEDSLDAEGKYEEYGY
NAQLSDRISLDRSIPDYRPKKCKQLMYPEDLPQISVVFIFVNEALSVILRSVHSVVNHTP
AHVLKEIILVDDNSDSVELKFNLDQYVNKRYPGLVKIVRNSKREGLIRARIHGWNAATAP
VVGFFDAHVEFNPGWAEPILTRMKEDHTRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQEWLDKGDETAPIRTPAMIGCSFVVDREYFGELGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCARVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEYKSHVYMAWNIP
MNNPGVDFGDVSERLALRKRLQCRSFRWYLEHVYPEMRIYNNTITYGEVRNSKASGYCLD
QGSEDDDKAILYPCHGMSSQLARYATEGLLQLGPLGSTTFLPDTKCLVDDGRGRTPRLKK
CDTVSRVSQRLWDFTQNGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIK
Download sequence
Identical sequences G3PHE7
ENSGACP00000017022 ENSGACP00000017022 69293.ENSGACP00000017022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]