SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000018397 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000018397
Domain Number 1 Region: 74-582
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 4e-182
Family Myeloperoxidase-like 0.000000000000593
Further Details:      
 
Domain Number 2 Region: 33-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000293
Family EGF-type module 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000018397
Sequence length 598
Comment (Gasterosteus aculeatus)
Sequence
RACSKLLQFLKLLLLESSLCAADSSVDTEGSSLNPCCYYPCQNSGVCVRFGTDRYQCDCT
RTGFYGDNCTVPHLWTTVRLALKPRPHVVHFILTHFQWFWDLVNCSFLRDTVMRLVLTVR
SDLIPSPPTYNTKYGYLNWESFYNTSYYTRLLPPVPEDCPLPMGAKGKAELPDPKVLTER
FFRRETFRPDPQGSNLMFVFMAQHFTHQFFKTDFKAEGGFTKALGHGVDASNIYGDNLVR
QHQLRLHRDGKMKYQTVEGEMYPPTASEVPVHMIYPENVPPEKRLVIGHEVFGLLPGLTM
YATIWLREHNRVCEILKAEHPTWDDEQLFQTTRLIIIGETINIIIEEYVQHLSGYLLNLK
FDPTLLFNARFQYSNRIALEFAHLYHWHPLMPDSFLIDGEDIPYSQFIYNSSLLTHYGVE
KMVDAFSQQAAGQIGGGRNSHAVVLKVAEMVIRESRATRVQPFNEYRKKFNLKPYTSFYD
FTDDTEMARGLEELYGDIDALEFYPGILLEKTRPNNLFGESMVEMGAPFSLKGLMGNPIC
SPEYWKPSTFGGETGFNIVKTSTLKKLVCLNTKWCPYVDFRVPRKEEETKPRETSTEL
Download sequence
Identical sequences G3PLB7
ENSGACP00000018397 69293.ENSGACP00000018397 ENSGACP00000018397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]