SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000019455 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000019455
Domain Number 1 Region: 972-1266
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-79
Family Protein kinases, catalytic subunit 0.000000000316
Further Details:      
 
Domain Number 2 Region: 329-490
Classification Level Classification E-value
Superfamily L domain-like 3.12e-48
Family L domain 0.00000406
Further Details:      
 
Domain Number 3 Region: 35-197
Classification Level Classification E-value
Superfamily L domain-like 3.97e-41
Family L domain 0.0000018
Further Details:      
 
Domain Number 4 Region: 485-604
Classification Level Classification E-value
Superfamily Fibronectin type III 2.15e-32
Family Fibronectin type III 0.0000173
Further Details:      
 
Domain Number 5 Region: 789-929
Classification Level Classification E-value
Superfamily Fibronectin type III 1.71e-20
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 6 Region: 606-686,795-816
Classification Level Classification E-value
Superfamily Fibronectin type III 2.06e-19
Family Fibronectin type III 0.00078
Further Details:      
 
Domain Number 7 Region: 174-331
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000455
Family Growth factor receptor domain 0.00000841
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000019455
Sequence length 1394
Comment (Gasterosteus aculeatus)
Sequence
MRSQAERSRLTLFWGLMLGLSSCLRPATAEICGPSIDIGNDIIEFRRLENCTVVEGYLQI
LLIGDKNNKNVQQDDFSSLSFPKLTMITDYLLLFRVSGLDSLSTLFPNLAVIRGRNLFYN
YALVIFEMTSLKDIGLHNLKNITRGAIRIEKNPELCYLDSIDWSLILDAEFNNYIAGNKQ
SKECSDVCPGIMENNPQCRKTMFNNNYNYRCWNSNYCQKECPEKCARQACTADGECCHPQ
CLGSCTAPESDTACAACAHYYHQGRCVADCPRDTYKFEGWRCISKEVCSKVHLPDFNSFV
IHGGECMSECPHGYMQATPNSMFCKACDGLCDKVCEEKVIDSVDAAQSLKGCTVIKGNLH
INIRRGHNMVAELESFTGLIQRVTGNVRIRHSHTLSSLAFLRNLRHIDGDNLLDDMYAFV
AVDNQQLQYLWDWKQHNLTIKAGKLSFRANPKLCMSEIRDMWNKTGIQGSFDESDFRNNG
DRASCESTILTFKSNTTSSTRIKLTWQRYRPPDYRDLISFIVYYKEAPFQNITEFEGQDG
CGSNSWNMVDVELRPDKDSDPGVLLSNLKPWTQYAVFVKAITLMVEDKHLPSAKSKVVYI
RTSPSAPSMPQDVRAYSNSTTQLVVRWSPPISPNGNQTYYLVRWQQQAEDRELYQHNYCS
KELKIPIRIAAIGVGDQEEETKPTKADDGPDKGPCCLCPKSVEDLEAEAADASYRKVFEN
FLHNSIFTPRPPDRRRRDLFAVANSTQPRRTRLHGNSSTAPPQQAAGNGSAAADVGPADI
EFDFVEQAVEERELQISGLQPFTVYRIDIHACSRQVQRCSAAEFVFSRTRPAEKADDIPG
PVTWDGHEDWVFLRWSEPPHPNGLILMYEIKFKLAAENEKHECVSGQTYRDQRGVRLSNL
GPGNYSVRVRATSLAGNGSWTHTLDLYVAERYENMLYTMIFVPILIVLFCLLVPLLVVLS
RKRSSDRLGNGVLYASVNPEYFSAAEMYVPDEWEVAREKITLNRELGQGSFGMVYEGLAK
GVVKDEAETRVAIKTVNESASMRGRIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIM
ELMTRGDLKSYLRSLRPKEQQWSSLSLPPLKKMLQMAGQIADGMAYLNANKFVHRDLAAR
NCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTTSDVWSFG
VVLWEIATLSEQPYQGLSNEQVLRFVMEGGLLEKPQNCPDMLFELMRMCWQYNPKMRPAF
VEIISSLKDELDPSFRELSFFYSADNKPPEAAHHHAEQMEDVDTVPLDPASPKRQPTPAP
QQTPPSPGSEAPPAPSLAPSSPSSPGTSSAATDKQPSGQPAANGLSLDELPPYTHMNGGR
KNERAMPLPQSSAC
Download sequence
Identical sequences G3PPC2
69293.ENSGACP00000019455 ENSGACP00000019455 ENSGACP00000019455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]