SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000020186 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000020186
Domain Number 1 Region: 241-265,292-451
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-36
Family Laminin G-like module 0.0000146
Further Details:      
 
Domain Number 2 Region: 466-671
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.55e-25
Family Laminin G-like module 0.0000488
Further Details:      
 
Domain Number 3 Region: 42-94
Classification Level Classification E-value
Superfamily GLA-domain 4.88e-20
Family GLA-domain 0.00054
Further Details:      
 
Domain Number 4 Region: 111-241
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000138
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000020186
Sequence length 678
Comment (Gasterosteus aculeatus)
Sequence
MWRRKRALGESLAGLVCLVTLVDAYRFLSQSTASQFLSRQRRANSLFEESKKGNLERECI
EELCNKEEAREIFENNPETEYFYPKYVACLGSHRVGINNPNSHAIPSDLRTCVTEISDQC
TPPPCYREGSNRCVDGQASFTCECKPGWKGRRCEDDIDECSDPEYPAGCNQKCYNLPGSF
HCMCEEGYFINDKVNCVDIDECLMYPSICKDMAKCVNTLGMYECQCPLGFKYDFPSKTCN
DIDECKLNVCDGKCINTAGSYSCHCDGRQHLYLGADERYCKMIPVCVDLYDYRHPEMLYL
GEQFAGLPVIFLRYRLPENTKFAAEFDFRTFDPEGVVLYAESSQDSWFMLGLRGGRIEVQ
FKNQHTFKVTSGGKAINDGQWHVISVDELEGSISVKISMEAVMSINSPDSLFTSVNGKLE
TKVYLAGLPNRTDNVIKPINPRLDGCIRGWNLMNQGASGVKEVIQEKKSKHCFVFVERGS
FFAGEGLAHFNIDYICVYNVGDSGSWNIDIKMNIRPSSSTGVLFALIHNNTVPLSVAVVT
RSLTSTLQNLQVFLDGVSVATLDSVMLCYPDRVTVQLNVTPTEIQISANSSTVAFVKSDA
LQEALKQLNSTMQNPISTYIGGIPVDVPLPATPVTAFYHGCMDIAINGQQLDFDDALSKH
NSIRSHSCPPVSPPESHP
Download sequence
Identical sequences G3PRF1
ENSGACP00000020186 69293.ENSGACP00000020186 ENSGACP00000020186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]