SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000020520 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000020520
Domain Number 1 Region: 10-177
Classification Level Classification E-value
Superfamily DNase I-like 2.36e-17
Family Sphingomyelin phosphodiesterase-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000020520
Sequence length 179
Comment (Gasterosteus aculeatus)
Sequence
MLKKSRITLLDSETVAYPTSGMMRSLLVAQVLFRGRKFCLMTSHFESCKANAAERMKQLR
LVMKRMAKVPDDVTVLFGGDTNLRDAEVAKVGLPGCVCDVWEQLGEPEDCRYTWDTHANT
NNDHRYKSRFRFDRLYLGRAGGDAALEPESMALVGLEKLKCGRYTSDHWGIYCTFSAVL
Download sequence
Identical sequences G3PSD4
ENSGACP00000020520 69293.ENSGACP00000020520 ENSGACP00000020520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]