SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000020910 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000020910
Domain Number 1 Region: 538-906
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.01e-126
Family Hect, E3 ligase catalytic domain 0.00000000436
Further Details:      
 
Domain Number 2 Region: 21-157
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.03e-28
Family PLC-like (P variant) 0.083
Further Details:      
 
Domain Number 3 Region: 482-521
Classification Level Classification E-value
Superfamily WW domain 0.000000000000138
Family WW domain 0.00027
Further Details:      
 
Domain Number 4 Region: 430-469
Classification Level Classification E-value
Superfamily WW domain 0.000000000000681
Family WW domain 0.00098
Further Details:      
 
Domain Number 5 Region: 339-381
Classification Level Classification E-value
Superfamily WW domain 0.00000000000487
Family WW domain 0.0013
Further Details:      
 
Domain Number 6 Region: 186-225
Classification Level Classification E-value
Superfamily WW domain 0.00000000000563
Family WW domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000020910
Sequence length 913
Comment (Gasterosteus aculeatus)
Sequence
SMAALSPQIRGLQIEEGDSRVLKVKVVAGIGLAKKDILGASDPYTRLSLYDPINGEITSL
QTKTIKKSLDPKWNEEFFFKVNPQKHRLLLEVFDENRLTRDDFLGQVDIPLNQIPTENPN
TERPYTFKDFLLHPRSHKSRVKGHLRLKMTYLPKSPGSEEETVEQTEDIDPGWEFLESQG
LSGRRQSQVLPALPPGWEERQDNLGRTFFVNHESRTTQWLRPTLQEGNVPVQRGQNNNMD
AEQVFMTRRQISDPDENTTRESPESWEIITEDESTLYHSNNQLTSSPPHGPGEFHSLHNE
QRNTNAASSCRIMLVFQVIPVAEEVPRLQQGRSILLILWWHIPISAGLPPGWEEKRDSKG
RRYFINHNSRSTSWTRPLIQVFFLSFIRINSSKKRQKTQSAAAAQSQTPPLPPMSPEDAP
SVHAPSTEAAHDSGSLPAGWEVRSAPSGRPFFINHTTKTTTWEDPRHPTVPVQVRNRPSL
DPSDLGPLPPAWEERIHTDGRIFYIDHNTKITQWDDPRLQNSAITGPAVPYSRDYKQKYD
YFRKKLKKPADIPNRFELKLRRNAVLEDSYRRILSVKRADLLKARLWVEFEGEKGLDYGG
VAREWFFLMSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVY
HGKLLDAFFIRPFYKMMLQKPITLQDMESVDSEYFNSLKWILENDPTDLDLRFTIDEELF
GQTHQHELKPGGADIVITNETKKEYIHLVMQWRFVNRIQKQMTAFKEGFFELIPQDVIKI
FDENELELLMCGLGDVDVNDWRENTKYKNSYCSNHVVILWFWKTVLLMDAEKRIRLLQFV
TGTSRVPMNGFAELYGSNGPQLFTIEQWGTRDKLPRAHTCFNRLDLPPYESFEELREKLH
IAIENAQGFDGVD
Download sequence
Identical sequences G3PTH4
ENSGACP00000020910 69293.ENSGACP00000020910 ENSGACP00000020910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]