SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000020928 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000020928
Domain Number 1 Region: 60-95
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000116
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 2-49
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000536
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000020928
Domain Number - Region: 456-493
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000782
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000020928
Sequence length 499
Comment (Gasterosteus aculeatus)
Sequence
PVDCVWGHWSEWSLCDNCTNSRRRTRSVEVFGQFGGDVCHGSMGDVESCEPDGVCTKPPP
PVCSDSEFQCESGPCISKRLQCNGDYDCEDGSDEDCEPLHKPCGRDVLDNNEQGRTAGYG
INILGLEPRINPFYNDFFNGRCTRVRNPYTLKHDRLPWNVGVLDYQTIVEETASKEIYEE
AHGVMKEMLTEDSLKAGVVVTLNFAAKAPSVTVLSNSTGKALAEAQFDRNKLIRDVNDYS
KVKNKSFMRVKGSVQLSTYRMRSRDLRTADEFLQHVKSLPIKYERGIYFAFLEDYGTHYT
KNGKTGGEYELIYVLNQDTIKKKDLTERKIQRCIKVGITADFTGFIQIKGDVNHGGCNAV
TNKDSVDDEGKAVVDKVLTSVRGGTLESAVAMRAKLNSDGVMDIPTFQNWARTLADLPAL
LYSEAEPIYMLVPLDMPGANTRISNLKRATADYVAEYNVCKCKPCHNGATLTLLGGRCVC
LCPHLYEGLACQNYKIDKA
Download sequence
Identical sequences G3PTJ2
ENSGACP00000020928 ENSGACP00000020928 69293.ENSGACP00000020928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]