SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000020982 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000020982
Domain Number 1 Region: 136-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 2 Region: 56-174
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000895
Family Growth factor receptor domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000020982
Sequence length 271
Comment (Gasterosteus aculeatus)
Sequence
MYRALLLSSLVLHVMGTPQFLGRHGRRVCGRDLRHSVATATESYVRPVHKPYITLCQGHR
LCSTYKTVYSVAYRQVSRAAPTSHLPSECCPGWRRFHSHNCNQAVCGQPCVNGGTCLRPN
QCTCPLGWKGHQCQTDVDECGEQRPCAQMCLNTAGSYRCACRDGFGLAGDGRSCQTKRTN
AERNLSEGFGQVENVTEEVQSLRNRVELLEKKLQLVLAPVSSFFPLSLDEGWSEKTTLLS
HSFQQLDRIDSLSEQIGFLEERIGTCSCQEN
Download sequence
Identical sequences G3PTP6
ENSGACP00000020982 69293.ENSGACP00000020982 ENSGACP00000020982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]