SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000021124 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000021124
Domain Number 1 Region: 49-105
Classification Level Classification E-value
Superfamily GLA-domain 3.53e-21
Family GLA-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000021124
Sequence length 205
Comment (Gasterosteus aculeatus)
Sequence
MLFLLLLLPLLSLGDLACVERVPSQQEAREVFVDDGDANGFLGRRLLFNRFDFEVFVPGN
LERECMEEVCNYEEAREVFENIPKTDDFWKQYIAEKDQQGTRVDVTSLLVGLIAVGVAII
ITGLLLCYFCQGKCKNMSRANSVQARPRRSNAPLIMRRLDEVSSQPVLPPPMEEIDPAGL
PSYEQAIAKNGPYDAPPPPYPGYLH
Download sequence
Identical sequences G3PU37
ENSGACP00000021124 69293.ENSGACP00000021124 ENSGACP00000021124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]