SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000021355 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000021355
Domain Number 1 Region: 110-434
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6.27e-54
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000019
Further Details:      
 
Domain Number 2 Region: 429-565
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.82e-31
Family Ricin B-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000021355
Sequence length 570
Comment (Gasterosteus aculeatus)
Sequence
MRRKSRILLCFAVLWVLGIAYYFYSGTALSRKGGGGGGGGARDDWGSSDSSSRSKTDDKT
HGLETLPPGKVRWQDFDQDLYVGATVVRPGQDPYARNKFNQVESDKLRMDRAVPDTRHDH
CRHKQWKSDLPASSVVITFHNEARSALLRTVVRFSVLKKSPSHLVKEIILVDDYSDNAED
GSLLGKMEKVRVLRNDRREGLMRSRVRGADAATAPVLTFLDSHCECNDHWLEPLLERVAE
DKTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTLDQRRARQGNPIAPIKT
PMIAGGLFVMDKDYFELLGKYDMMMDVWGGENLVEISFRVWQCGGSLEIIPCSRVGHVFR
KQHPYTFPGGSGTVFARNTRRAAEVWMDEFKNFYYAAVPSARNVPYGNIQSRMEMKKRLG
CQPFKWYLENVYPELRRVPDHQDIAFGALQQGGNCLDTLGHFADGVVGVYECHNAGGNQE
WALTKDKSVKHMDLCLTVVDRTAGSLIKLQGCRENDSRQKWEQIESNSKLRHLGSNLCLD
SRSARMGGLTVEVCSPSLNQQWKFTLNLQS
Download sequence
Identical sequences G3PUR8
ENSGACP00000021355 69293.ENSGACP00000021355 ENSGACP00000021355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]