SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000021468 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000021468
Domain Number 1 Region: 108-177
Classification Level Classification E-value
Superfamily RING/U-box 2.94e-19
Family ZZ domain 0.016
Further Details:      
 
Domain Number 2 Region: 366-413
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000995
Family UBA domain 0.0003
Further Details:      
 
Domain Number 3 Region: 31-86
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000106
Family PB1 domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000021468
Sequence length 421
Comment (Gasterosteus aculeatus)
Sequence
IMSVTVKAYLLGKDESVKEVRRFTVDHDVSSSYEYLLRKTTSVFSNLKPKTTNTYHRDED
EDLVAFSSDDELMMGLTCMKDSTFRLFIKEKKENRRDVRPPHGAPQAVPHHMTPPPLHCD
VTCDGCEGPVVGTRFKCSVCPNYDLCSSCQAQGTHTEHPLLPIWHPLQWFPRGKWMKRMR
HCMWNQNLNLNPAQDQDKTGTSKPSDSSAPSASQANVDYLMNIGEGVAALLNPLGIDVDI
DVEHEGQRSKVTPPPSANPPTQSGKVEDKVDEARTEGSKVRKTVRPTGGGVNYTVLRALL
QWLGKHYDTNLLDVSRDSDEEWTHLSPKEVDPSTGELQSLQPQDLNQGPPLGQTGLKEAA
LYPHLPQEADPRLVESLSLMLSMGFTDEGGWLTRLLQAKNFDIGAALDAIQYAKPPRSHQ
P
Download sequence
Identical sequences G3PV31
ENSGACP00000021468 ENSGACP00000021468 69293.ENSGACP00000021468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]