SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000021553 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000021553
Domain Number 1 Region: 540-585
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000589
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 112-148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 54-102
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000021553
Domain Number - Region: 495-531
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000107
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000021553
Sequence length 586
Comment (Gasterosteus aculeatus)
Sequence
LHFQLIPFLQLTYNCLLCVTLVLLSYVAVTKADNEEPSVRQARSAADQVVVHPVDCVLSG
WSSWSRCDVCQKKRFRYAKLDQPSQFGGQPCNFYGEEEEACAVPAHYTCVTVPLCEGFLC
NQTGRCIPRTLQCSGEDDCGDMSDEAGCKNVPKPCSSEAEEYWGIENLAKGINILNSNLG
GVVLDNRYYAGSCLPHYIEDVRFRKPYNLLHYTLQTKGSYDFTMQSFKSYKEYKDHVVKE
HYSQTTFSFGIAVPGVFEVAFNFNNEKYSKAERKIRRASSKTNSFVRAKAELELAQYILK
SDDLMLHPEFLQRLRSLPQTYVYGEYRQIYRDYGTHYITEAALGGDYEYTVILNKEKLEK
TGNYSLDDYKRCTQAGLKVGANIKGIYVALGIQGGSCDALLNEFGEDTEHGSMVEDFVSV
VRGGSSETITALVSKKLPTPELMGLWGEGVRYNPDFIRKTIRPLFELVISRDFSYPEILK
RNLRRALSEYLAEASPCRCAPCRNNGVAVLKGTRCDCVCPVGYSGRGCEITSRRKEIAIE
GSWSCWGAWSPCSGGTMTRSRQCNNPAPSEEDLACRGLKQESTECF
Download sequence
Identical sequences G3PVB6
ENSGACP00000021553 69293.ENSGACP00000021553 ENSGACP00000021553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]